Lineage for d2bs2e1 (2bs2 E:107-240)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1718664Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1718665Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1718723Protein automated matches [231469] (4 species)
    not a true protein
  7. 1718739Species Wolinella succinogenes [TaxId:844] [255062] (1 PDB entry)
  8. 1718741Domain d2bs2e1: 2bs2 E:107-240 [129039]
    Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b2, d2bs2c_, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e2, d2bs2f_
    automated match to d2bs2e1
    complexed with f3s, fad, fes, fum, hem, lmt, na, sf4

Details for d2bs2e1

PDB Entry: 2bs2 (more details), 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (E:) quinol-fumarate reductase iron-sulfur subunit b

SCOPe Domain Sequences for d2bs2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs2e1 a.1.2.1 (E:107-240) automated matches {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvnm

SCOPe Domain Coordinates for d2bs2e1:

Click to download the PDB-style file with coordinates for d2bs2e1.
(The format of our PDB-style files is described here.)

Timeline for d2bs2e1: