Lineage for d2bp7h1 (2bp7 H:2-205)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122459Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
    automatically mapped to Pfam PF02779
  6. Protein automated matches [254489] (1 species)
    not a true protein
  7. Species Pseudomonas putida [TaxId:303] [255058] (1 PDB entry)
  8. 2122540Domain d2bp7h1: 2bp7 H:2-205 [128936]
    Other proteins in same PDB: d2bp7a_, d2bp7b2, d2bp7c_, d2bp7d2, d2bp7e_, d2bp7f2, d2bp7g_, d2bp7h2
    automated match to d1qs0b1

Details for d2bp7h1

PDB Entry: 2bp7 (more details), 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)
PDB Compounds: (H:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bp7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp7h1 c.36.1.7 (H:2-205) automated matches {Pseudomonas putida [TaxId: 303]}
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdg

SCOPe Domain Coordinates for d2bp7h1:

Click to download the PDB-style file with coordinates for d2bp7h1.
(The format of our PDB-style files is described here.)

Timeline for d2bp7h1: