| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein Potassium channel protein [56901] (3 species) |
| Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
| Domain d2bobc_: 2bob C: [128907] Other proteins in same PDB: d2boba1, d2boba2, d2boba3, d2bobb1, d2bobb2 automated match to d1r3jc_ complexed with co, tba, tl |
PDB Entry: 2bob (more details), 2.76 Å
SCOPe Domain Sequences for d2bobc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bobc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2bobc_: