Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.10: TM1459-like [101976] (2 proteins) |
Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species) |
Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries) Uniprot Q56185 77-198 |
Domain d2bnoa2: 2bno A:77-198 [128844] Other proteins in same PDB: d2bnoa1, d2bnob1 automatically matched to 1ZZ6 A:77-198 complexed with hg, so4, zn |
PDB Entry: 2bno (more details), 1.9 Å
SCOPe Domain Sequences for d2bnoa2:
Sequence, based on SEQRES records: (download)
>d2bnoa2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav nf
>d2bnoa2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} dlddgviiqmpderpilknvdyyvynclvrtkrapslvplvvdvltdnpddakfnsghag neflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliavnf
Timeline for d2bnoa2: