Lineage for d2bnna1 (2bnn A:5-76)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268157Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1268166Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 1268167Species Streptomyces wedmorensis [TaxId:43759] [140517] (13 PDB entries)
    Uniprot Q56185 6-76
  8. 1268180Domain d2bnna1: 2bnn A:5-76 [128839]
    Other proteins in same PDB: d2bnna2, d2bnnb2
    automated match to d1zz6a1
    complexed with fcn, zn

Details for d2bnna1

PDB Entry: 2bnn (more details), 2.5 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d2bnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnna1 a.35.1.3 (A:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn

SCOPe Domain Coordinates for d2bnna1:

Click to download the PDB-style file with coordinates for d2bnna1.
(The format of our PDB-style files is described here.)

Timeline for d2bnna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnna2