Lineage for d2bnna1 (2bnn A:6-76)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640325Family a.35.1.3: SinR domain-like [47432] (5 proteins)
  6. 640326Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 640327Species Streptomyces wedmorensis [TaxId:43759] [140517] (9 PDB entries)
  8. 640341Domain d2bnna1: 2bnn A:6-76 [128839]
    Other proteins in same PDB: d2bnna2, d2bnnb2
    automatically matched to 1ZZ6 A:6-76
    complexed with fcn, zn

Details for d2bnna1

PDB Entry: 2bnn (more details), 2.5 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
PDB Compounds: (A:) epoxidase

SCOP Domain Sequences for d2bnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnna1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOP Domain Coordinates for d2bnna1:

Click to download the PDB-style file with coordinates for d2bnna1.
(The format of our PDB-style files is described here.)

Timeline for d2bnna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnna2