Lineage for d2bkra_ (2bkr A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399503Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1399542Protein automated matches [190219] (1 species)
    not a true protein
  7. 1399543Species Human (Homo sapiens) [TaxId:9606] [186979] (5 PDB entries)
  8. 1399544Domain d2bkra_: 2bkr A: [128710]
    Other proteins in same PDB: d2bkrb_
    automated match to d1xt9a_

Details for d2bkra_

PDB Entry: 2bkr (more details), 1.9 Å

PDB Description: nedd8 nedp1 complex
PDB Compounds: (A:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkra_ d.3.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

SCOPe Domain Coordinates for d2bkra_:

Click to download the PDB-style file with coordinates for d2bkra_.
(The format of our PDB-style files is described here.)

Timeline for d2bkra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bkrb_