SCOPe 2.04: Domain d2bkra_: 2bkr A:

Lineage for d2bkra_ (2bkr A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein automated matches [190219] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186979] (5 PDB entries)

8. Domain d2bkra_: 2bkr A: [128710]
   Other proteins in same PDB: d2bkrb_
   automated match to d1xt9a_

Details for d2bkra_

PDB Entry: 2bkr, 1.9 Å

PDB Description: nedd8 nedp1 complex

PDB Compounds: (A:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkra_:

Sequence; same for both SEQRES and ATOM records:

>d2bkra_ d.3.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

Timeline for d2bkra_:

• d2bkra_ first appeared in SCOP 1.73, called d2bkra1
  
• d2bkra_ appears in SCOPe 2.03
  
• d2bkra_ appears in SCOPe 2.05
  
• d2bkra_ appears in the current release, SCOPe 2.08