Lineage for d2bhda2 (2bhd A:177-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214036Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2214037Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2214038Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2214039Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2214040Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2214068Domain d2bhda2: 2bhd A:177-440 [128525]
    Other proteins in same PDB: d2bhda1
    automated match to d1n51a2
    complexed with flc, mg

Details for d2bhda2

PDB Entry: 2bhd (more details), 2.5 Å

PDB Description: mg substituted e. coli aminopeptidase p in complex with product
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2bhda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhda2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2bhda2:

Click to download the PDB-style file with coordinates for d2bhda2.
(The format of our PDB-style files is described here.)

Timeline for d2bhda2: