SCOP 1.73: Domain d2bedb1: 2bed B:23-423

Lineage for d2bedb1 (2bed B:23-423)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (27 PDB entries)

8. Domain d2bedb1: 2bed B:23-423 [128376]
   Other proteins in same PDB: d2beda1
   automatically matched to d1ft1b_
   complexed with 736, fpp, zn

Details for d2bedb1

PDB Entry: 2bed, 2.7 Å

PDB Description: structure of fpt bound to inhibitor sch207736

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOP Domain Sequences for d2bedb1:

Sequence; same for both SEQRES and ATOM records:

>d2bedb1 a.102.4.3 (B:23-423) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d2bedb1:

• d2bedb1 is new in SCOP 1.73
  
• d2bedb1 appears in SCOP 1.75
  
• d2bedb1 appears in the current release, SCOPe 2.08, called d2bedb_