Class a: All alpha proteins [46456] (258 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (27 PDB entries) |
Domain d2bedb1: 2bed B:23-423 [128376] Other proteins in same PDB: d2beda1 automatically matched to d1ft1b_ complexed with 736, fpp, zn |
PDB Entry: 2bed (more details), 2.7 Å
SCOP Domain Sequences for d2bedb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bedb1 a.102.4.3 (B:23-423) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
Timeline for d2bedb1: