Class a: All alpha proteins [46456] (258 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (27 PDB entries) |
Domain d1ft1b_: 1ft1 B: [18867] Other proteins in same PDB: d1ft1a_ complexed with zn |
PDB Entry: 1ft1 (more details), 2.25 Å
SCOP Domain Sequences for d1ft1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft1b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfeecedavtsdpatd
Timeline for d1ft1b_: