Lineage for d2bdra1 (2bdr A:1-166)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 962885Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 963262Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
    Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold
  6. 963263Protein Ureidoglycolate hydrolase AllA [117313] (4 species)
  7. 963268Species Pseudomonas putida [TaxId:303] [141603] (1 PDB entry)
    Uniprot P59285 1-166
  8. 963269Domain d2bdra1: 2bdr A:1-166 [128342]
    complexed with na

Details for d2bdra1

PDB Entry: 2bdr (more details), 1.6 Å

PDB Description: crystal structure of the putative ureidoglycolate hydrolase pp4288 from pseudomonas putida, northeast structural genomics target ppr49
PDB Compounds: (A:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d2bdra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdra1 b.82.1.14 (A:1-166) Ureidoglycolate hydrolase AllA {Pseudomonas putida [TaxId: 303]}
mrtlmiepltkeafaqfgdvietdgsdhfminngstmrfhklatvetaepedkaiisifr
adaqdmpltvrmlerhplgsqafipllgnpflivvapvgdapvsglvrafrsngrqgvny
hrgvwhhpvltiekrddflvvdrsgsgnncdehyfteeqmlilnph

SCOPe Domain Coordinates for d2bdra1:

Click to download the PDB-style file with coordinates for d2bdra1.
(The format of our PDB-style files is described here.)

Timeline for d2bdra1: