Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (2 species) |
Species Thermus thermophilus [TaxId:274] [50305] (36 PDB entries) |
Domain d2b9oq1: 2b9o Q:2-105 [128179] Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9op1, d2b9or1, d2b9os1, d2b9ot1 automatically matched to d1fjgq_ complexed with psu, yyg |
PDB Entry: 2b9o (more details), 6.46 Å
SCOP Domain Sequences for d2b9oq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9oq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d2b9oq1: