Lineage for d2b9op1 (2b9o P:1-83)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720771Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 720772Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 720773Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 720774Protein Ribosomal protein S16 [54567] (1 species)
  7. 720775Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
  8. 720812Domain d2b9op1: 2b9o P:1-83 [128178]
    Other proteins in same PDB: d2b9ob1, d2b9oc1, d2b9oc2, d2b9od1, d2b9oe1, d2b9oe2, d2b9of1, d2b9og1, d2b9oh1, d2b9oi1, d2b9oj1, d2b9ok1, d2b9ol1, d2b9om1, d2b9on1, d2b9oo1, d2b9oq1, d2b9or1, d2b9os1, d2b9ot1
    automatically matched to d1emwa_
    complexed with psu, yyg

Details for d2b9op1

PDB Entry: 2b9o (more details), 6.46 Å

PDB Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2b9op1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9op1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d2b9op1:

Click to download the PDB-style file with coordinates for d2b9op1.
(The format of our PDB-style files is described here.)

Timeline for d2b9op1: