Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries) |
Domain d2b9md1: 2b9m D:2-209 [128128] Other proteins in same PDB: d2b9mb1, d2b9mc1, d2b9mc2, d2b9me1, d2b9me2, d2b9mf1, d2b9mg1, d2b9mh1, d2b9mi1, d2b9mj1, d2b9mk1, d2b9ml1, d2b9mm1, d2b9mn1, d2b9mo1, d2b9mp1, d2b9mq1, d2b9mr1, d2b9ms1, d2b9mt1, d2b9mu1 protein/RNA complex protein/RNA complex |
PDB Entry: 2b9m (more details), 6.76 Å
SCOPe Domain Sequences for d2b9md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9md1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvneqlviefysr
Timeline for d2b9md1: