Lineage for d2b8qb1 (2b8q B:2-129)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027568Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1027660Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)
    Uniprot Q5UQL3 2-137
  8. 1027662Domain d2b8qb1: 2b8q B:2-129 [128104]
    automatically matched to 2B8P A:2-129
    complexed with mg, po4, tyd

Details for d2b8qb1

PDB Entry: 2b8q (more details), 2.5 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with TDP
PDB Compounds: (B:) Probable nucleoside diphosphate kinase

SCOPe Domain Sequences for d2b8qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8qb1 d.58.6.1 (B:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

SCOPe Domain Coordinates for d2b8qb1:

Click to download the PDB-style file with coordinates for d2b8qb1.
(The format of our PDB-style files is described here.)

Timeline for d2b8qb1: