Lineage for d2b76b1 (2b76 B:106-243)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1979697Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1979698Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1979699Protein Fumarate reductase [46550] (3 species)
  7. 1979703Species Escherichia coli [TaxId:562] [46551] (6 PDB entries)
  8. 1979712Domain d2b76b1: 2b76 B:106-243 [128012]
    Other proteins in same PDB: d2b76a1, d2b76a2, d2b76a3, d2b76b2, d2b76c1, d2b76d1, d2b76m1, d2b76m2, d2b76m3, d2b76n2, d2b76o1, d2b76p1
    automatically matched to d1kf6b1
    complexed with f3s, fad, fes, flc, mq7, sf4; mutant

Details for d2b76b1

PDB Entry: 2b76 (more details), 3.3 Å

PDB Description: e. coli quinol fumarate reductase frda e49q mutation
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d2b76b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b76b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOPe Domain Coordinates for d2b76b1:

Click to download the PDB-style file with coordinates for d2b76b1.
(The format of our PDB-style files is described here.)

Timeline for d2b76b1: