![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.4: HIV integrase-binding domain [140576] (2 families) ![]() |
![]() | Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins) N-terminal part of PfamB PB012949 |
![]() | Protein PC4 and SFRS1-interacting protein, PSIP1 [140578] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140579] (2 PDB entries) Uniprot O75475 346-426! Uniprot O75475 347-429 |
![]() | Domain d2b4jd2: 2b4j D:347-426 [127836] Other proteins in same PDB: d2b4ja_, d2b4jb_, d2b4jc2, d2b4jd3 automated match to d1z9ea1 complexed with gol, po4 |
PDB Entry: 2b4j (more details), 2.02 Å
SCOPe Domain Sequences for d2b4jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4jd2 a.48.4.1 (D:347-426) PC4 and SFRS1-interacting protein, PSIP1 {Human (Homo sapiens) [TaxId: 9606]} smdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrf kvsqvimekstmlynkfknm
Timeline for d2b4jd2:
![]() Domains from other chains: (mouse over for more information) d2b4ja_, d2b4jb_, d2b4jc1, d2b4jc2 |