Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) |
Domain d2b2xm1: 2b2x M:1-114 [127752] Other proteins in same PDB: d2b2xa_, d2b2xb_, d2b2xl2, d2b2xm2 automated match to d2fbjl1 complexed with mg; mutant |
PDB Entry: 2b2x (more details), 2.2 Å
SCOPe Domain Sequences for d2b2xm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2xm1 b.1.1.0 (M:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qiqltqspsslsasvgdrvtitcsassqvnhmfwyqqkpgkapkpwiyltsylasgvpsr fsgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveikrad
Timeline for d2b2xm1:
View in 3D Domains from other chains: (mouse over for more information) d2b2xa_, d2b2xb_, d2b2xl1, d2b2xl2 |