Lineage for d2b24d_ (2b24 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641078Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1641134Protein automated matches [190223] (4 species)
    not a true protein
  7. 1641202Species Rhodococcus sp. [TaxId:92694] [255044] (1 PDB entry)
  8. 1641204Domain d2b24d_: 2b24 D: [127695]
    Other proteins in same PDB: d2b24a1, d2b24a2, d2b24c1, d2b24c2, d2b24e1, d2b24e2
    automated match to d2b1xb1
    complexed with fe, fes, ind

Details for d2b24d_

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (D:) naphthalene dioxygenase small subunit

SCOPe Domain Sequences for d2b24d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24d_ d.17.4.4 (D:) automated matches {Rhodococcus sp. [TaxId: 92694]}
sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim

SCOPe Domain Coordinates for d2b24d_:

Click to download the PDB-style file with coordinates for d2b24d_.
(The format of our PDB-style files is described here.)

Timeline for d2b24d_: