SCOPe 2.05: Domain d2azxa1: 2azx A:82-468

Lineage for d2azxa1 (2azx A:82-468)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
   overall structure is similar to TyrRS

7. Species Human (Homo sapiens) [TaxId:9606] [102256] (11 PDB entries)
   Uniprot P23381 94-471

8. Domain d2azxa1: 2azx A:82-468 [127616]
   automatically matched to d1r6ua_
   protein/RNA complex; complexed with gol, mg, so4, trp

Details for d2azxa1

PDB Entry: 2azx, 2.8 Å

PDB Description: Charged and uncharged tRNAs adopt distinct conformations when complexed with human tryptophanyl-tRNA synthetase

PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2azxa1:

Sequence; same for both SEQRES and ATOM records:

>d2azxa1 c.26.1.1 (A:82-468) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
lwkdltldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
iaehqarrkevtdeivkefmtprklsf

Timeline for d2azxa1:

• d2azxa1 first appeared in SCOP 1.73
  
• d2azxa1 appears in SCOPe 2.04
  
• d2azxa1 appears in SCOPe 2.06
  
• d2azxa1 appears in the current release, SCOPe 2.08