![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (21 species) |
![]() | Species Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries) Uniprot P61136 4-158 |
![]() | Domain d2az1a1: 2az1 A:4-158 [127580] complexed with ca |
PDB Entry: 2az1 (more details), 2.35 Å
SCOPe Domain Sequences for d2az1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2az1a1 d.58.6.1 (A:4-158) Nucleoside diphosphate kinase, NDK {Halobacterium salinarum [TaxId: 2242]} hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh edeganereialffdddelvdwdrdasawvyedla
Timeline for d2az1a1: