Lineage for d2az1a1 (2az1 A:4-158)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027568Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1027595Species Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries)
    Uniprot P61136 4-158
  8. 1027605Domain d2az1a1: 2az1 A:4-158 [127580]
    complexed with ca

Details for d2az1a1

PDB Entry: 2az1 (more details), 2.35 Å

PDB Description: structure of a halophilic nucleoside diphosphate kinase from halobacterium salinarum
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2az1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az1a1 d.58.6.1 (A:4-158) Nucleoside diphosphate kinase, NDK {Halobacterium salinarum [TaxId: 2242]}
hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
edeganereialffdddelvdwdrdasawvyedla

SCOPe Domain Coordinates for d2az1a1:

Click to download the PDB-style file with coordinates for d2az1a1.
(The format of our PDB-style files is described here.)

Timeline for d2az1a1: