Lineage for d2ayxa1 (2ayx A:817-949)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837911Protein Sensor kinase protein RcsC, C-terminal domain [142023] (1 species)
  7. 1837912Species Escherichia coli [TaxId:562] [142024] (2 PDB entries)
    Uniprot P14376 817-949
  8. 1837914Domain d2ayxa1: 2ayx A:817-949 [127574]
    Other proteins in same PDB: d2ayxa2

Details for d2ayxa1

PDB Entry: 2ayx (more details)

PDB Description: solution structure of the e.coli rcsc c-terminus (residues 700-949) containing linker region and phosphoreceiver domain
PDB Compounds: (A:) Sensor kinase protein rcsC

SCOPe Domain Sequences for d2ayxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]}
kavsdnddmmilvvddhpinrrlladqlgslgyqcktandgvdalnvlsknhidivlsdv
nmpnmdgyrltqrirqlgltlpvigvtanalaeekqrclesgmdsclskpvtldvikqtl
tlyaervrksrds

SCOPe Domain Coordinates for d2ayxa1:

Click to download the PDB-style file with coordinates for d2ayxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ayxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ayxa2