Lineage for d2axvd2 (2axv D:67-303)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339910Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2339939Protein automated matches [254479] (1 species)
    not a true protein
  7. 2339940Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)
  8. 2339955Domain d2axvd2: 2axv D:67-303 [127531]
    Other proteins in same PDB: d2axva1, d2axvb1, d2axvc1, d2axvd1
    automated match to d2awia2
    mutant

Details for d2axvd2

PDB Entry: 2axv (more details), 3 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (D:) PrgX

SCOPe Domain Sequences for d2axvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axvd2 a.118.8.4 (D:67-303) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv

SCOPe Domain Coordinates for d2axvd2:

Click to download the PDB-style file with coordinates for d2axvd2.
(The format of our PDB-style files is described here.)

Timeline for d2axvd2: