Lineage for d2axvb1 (2axv B:2-66)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322951Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2322952Protein automated matches [190907] (17 species)
    not a true protein
  7. 2323012Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. 2323025Domain d2axvb1: 2axv B:2-66 [127526]
    Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2
    automated match to d2awia1
    mutant

Details for d2axvb1

PDB Entry: 2axv (more details), 3 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axvb1 a.35.1.0 (B:2-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnrag

SCOPe Domain Coordinates for d2axvb1:

Click to download the PDB-style file with coordinates for d2axvb1.
(The format of our PDB-style files is described here.)

Timeline for d2axvb1: