Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
Protein automated matches [231324] (4 species) not a true protein |
Domain d2atla1: 2atl A:241-341 [127296] Other proteins in same PDB: d2atla2, d2atla3, d2atlb2, d2atlb3 automated match to d1jx4a1 protein/DNA complex; complexed with ca, dcp |
PDB Entry: 2atl (more details), 2.8 Å
SCOPe Domain Sequences for d2atla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atla1 d.240.1.0 (A:241-341) automated matches {Sulfolobus solfataricus [TaxId: 2287]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d2atla1: