Class b: All beta proteins [48724] (176 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins) Pfam PF01878; DUF55 |
Protein Hypothetical protein LmjF36.6870 [141714] (1 species) |
Species Leishmania major [TaxId:5664] [141715] (1 PDB entry) Uniprot Q4Q067 7-163 |
Domain d2ar1a1: 2ar1 A:7-163 [127187] complexed with gol |
PDB Entry: 2ar1 (more details), 1.6 Å
SCOPe Domain Sequences for d2ar1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ar1a1 b.122.1.8 (A:7-163) Hypothetical protein LmjF36.6870 {Leishmania major [TaxId: 5664]} raedihywllksephkfsiddlakqktspwdgvrnyaarnnmramsvgdkvlfyhsntke pgvaglaevvrlayddftaldktseyfdpkatkeknpwkmvdvkfvarwdtvltlhelks rrelqkmalftqrrlsvqpvsaseyayilrmneeqqr
Timeline for d2ar1a1: