SCOPe 2.06: Domain d2amcb4: 2amc B:191-399

Lineage for d2amcb4 (2amc B:191-399)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.153: PheT/TilS domain [56036] (1 superfamily)
   core: 3 layers; contains beta-sandwich of unusual topology

4. Superfamily b.153.1: PheT/TilS domain [56037] (2 families)
   contains putative tRNA-binding structural motif

5. Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
   Pfam PF03483; decorated with additional structures

6. Protein B3/B4 domain of PheRS, PheT [56039] (1 species)

7. Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2amcb4: 2amc B:191-399 [127006]
   Other proteins in same PDB: d2amca_, d2amcb1, d2amcb2, d2amcb3, d2amcb5, d2amcb6
   automated match to d1jjcb6
   protein/RNA complex; complexed with mg, so4, tyr

Details for d2amcb4

PDB Entry: 2amc, 2.7 Å

PDB Description: crystal structure of phenylalanyl-trna synthetase complexed with l- tyrosine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2amcb4:

Sequence; same for both SEQRES and ATOM records:

>d2amcb4 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

Timeline for d2amcb4:

• d2amcb4 first appeared in SCOP 1.73
  
• d2amcb4 appears in SCOPe 2.05
  
• d2amcb4 appears in SCOPe 2.07
  
• d2amcb4 appears in the current release, SCOPe 2.08