Lineage for d2alyb1 (2aly B:1-38,B:152-190)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985673Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1985674Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1985675Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 1985676Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 1985677Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1985682Domain d2alyb1: 2aly B:1-38,B:152-190 [126988]
    Other proteins in same PDB: d2alya_, d2alyb3, d2alyb4, d2alyb5, d2alyb6
    automated match to d1jjcb1
    protein/RNA complex; complexed with mn, so4, ysa

Details for d2alyb1

PDB Entry: 2aly (more details), 2.6 Å

PDB Description: crystal structure of t.thermophilus phenylalanyl-trna synthetase complexed with 5'-o-[n-(l-tyrosyl)sulphamoyl]adenosine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2alyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alyb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOPe Domain Coordinates for d2alyb1:

Click to download the PDB-style file with coordinates for d2alyb1.
(The format of our PDB-style files is described here.)

Timeline for d2alyb1: