SCOPe 2.02: Domain d2alaa2: 2ala A:1-292

Lineage for d2alaa2 (2ala A:1-292)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)

6. Protein Fusion glycoprotein E1 [75656] (1 species)

7. Species Semliki forest virus [TaxId:11033] [75657] (3 PDB entries)

8. Domain d2alaa2: 2ala A:1-292 [126974]
   Other proteins in same PDB: d2alaa1
   automatically matched to d1i9wa2

Details for d2alaa2

PDB Entry: 2ala, 3 Å

PDB Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.

PDB Compounds: (A:) Structural polyprotein (P130)

SCOPe Domain Sequences for d2alaa2:

Sequence; same for both SEQRES and ATOM records:

>d2alaa2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

Timeline for d2alaa2:

• d2alaa2 first appeared in SCOP 1.73
  
• d2alaa2 appears in SCOPe 2.01
  
• d2alaa2 appears in SCOPe 2.03
  
• d2alaa2 appears in the current release, SCOPe 2.08