Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Pf GST [101210] (1 species) cannot be assigned to any of the known GST classes |
Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (4 PDB entries) |
Domain d2aawc1: 2aaw C:86-211 [126498] Other proteins in same PDB: d2aawa2, d2aawc2 automatically matched to d1okta1 complexed with dtl, gtx, p33 |
PDB Entry: 2aaw (more details), 2.4 Å
SCOPe Domain Sequences for d2aawc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aawc1 a.45.1.1 (C:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn rkesvy
Timeline for d2aawc1: