Lineage for d2aame_ (2aam E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341153Family c.1.8.15: TM1410-like [141796] (1 protein)
    Pfam PF03537
  6. 1341154Protein Hypothetical protein TM1410 [141797] (1 species)
  7. 1341155Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)
    Uniprot Q9X1D0 28-312
  8. 1341160Domain d2aame_: 2aam E: [126493]
    automated match to d2aama1
    complexed with gol, unl

Details for d2aame_

PDB Entry: 2aam (more details), 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution
PDB Compounds: (E:) Hypothetical protein TM1410

SCOPe Domain Sequences for d2aame_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aame_ c.1.8.15 (E:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppea

SCOPe Domain Coordinates for d2aame_:

Click to download the PDB-style file with coordinates for d2aame_.
(The format of our PDB-style files is described here.)

Timeline for d2aame_: