SCOP 1.73: Domain d2aame1: 2aam E:28-312

Lineage for d2aame1 (2aam E:28-312)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.15: TM1410-like [141796] (1 protein)
   Pfam PF03537

6. Protein Hypothetical protein TM1410 [141797] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)

8. Domain d2aame1: 2aam E:28-312 [126493]
   automatically matched to 2AAM A:28-312
   complexed with gol, unl

Details for d2aame1

PDB Entry: 2aam, 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution

PDB Compounds: (E:) Hypothetical protein TM1410

SCOP Domain Sequences for d2aame1:

Sequence; same for both SEQRES and ATOM records:

>d2aame1 c.1.8.15 (E:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
egwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvpv
ayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvid
qgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngeni
ldfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddgs
dsfenisrildyyekakrngcipyaarsdleldemnviegiqppe

Timeline for d2aame1:

• d2aame1 is new in SCOP 1.73
  
• d2aame1 appears in SCOP 1.75
  
• d2aame1 appears in the current release, SCOPe 2.08, called d2aame_