Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.15: TM1410-like [141796] (1 protein) Pfam PF03537 |
Protein Hypothetical protein TM1410 [141797] (1 species) |
Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry) Uniprot Q9X1D0 28-312 |
Domain d2aama1: 2aam A:28-312 [126489] complexed with gol, unl |
PDB Entry: 2aam (more details), 2.2 Å
SCOPe Domain Sequences for d2aama1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} egwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvpv ayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvid qgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngeni ldfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddgs dsfenisrildyyekakrngcipyaarsdleldemnviegiqppe
Timeline for d2aama1: