SCOPe 2.08: Domain d2a6ta1: 2a6t A:1-94

Lineage for d2a6ta1 (2a6t A:1-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
   4 helices; orthogonal array of two alpha hairpins

4. Superfamily a.242.1: Dcp2 domain-like [140586] (2 families)
   automatically mapped to Pfam PF05026

5. Family a.242.1.1: Dcp2 box A domain [140587] (1 protein)
   Pfam PF05026

6. Protein mRNA decapping enzyme Dcp2p, N-terminal domain [140588] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [140589] (3 PDB entries)
   Uniprot O13828 1-94

8. Domain d2a6ta1: 2a6t A:1-94 [126309]
   Other proteins in same PDB: d2a6ta2, d2a6tb1

Details for d2a6ta1

PDB Entry: 2a6t, 2.5 Å

PDB Description: Crystal structure of S.pombe mRNA decapping enzyme Dcp2p

PDB Compounds: (A:) spac19a8.12

SCOPe Domain Sequences for d2a6ta1:

Sequence, based on SEQRES records:

>d2a6ta1 a.242.1.1 (A:1-94) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvheeafddflrykt

Sequence, based on observed residues (ATOM records):

>d2a6ta1 a.242.1.1 (A:1-94) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwheeafddflrykt

Timeline for d2a6ta1:

• d2a6ta1 first appeared in SCOP 1.73
  
• d2a6ta1 appears in SCOPe 2.07