SCOP 1.75: Domain d2a6ab1: 2a6a B:1-103

Lineage for d2a6ab1 (2a6a B:1-103)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.9: YeaZ-like [110633] (2 proteins)
   Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity

6. Protein Hypothetical protein TM0874 [142467] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142468] (1 PDB entry)
   Uniprot Q9WZX7 1-103! Uniprot Q9WZX7 104-193

8. Domain d2a6ab1: 2a6a B:1-103 [126233]
   automatically matched to 2A6A A:1-103
   complexed with unl

Details for d2a6ab1

PDB Entry: 2a6a, 2.5 Å

PDB Description: crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution

PDB Compounds: (B:) hypothetical protein TM0874

SCOP Domain Sequences for d2a6ab1:

Sequence; same for both SEQRES and ATOM records:

>d2a6ab1 c.55.1.9 (B:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]}
mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
gigpggltglrvgiatvvglvspydipvaplnsfemtakscpa

Timeline for d2a6ab1:

• d2a6ab1 first appeared in SCOP 1.73
  
• d2a6ab1 appears in SCOPe 2.01
  
• d2a6ab1 appears in the current release, SCOPe 2.08