Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.9: YeaZ-like [110633] (2 proteins) Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity |
Protein Hypothetical protein TM0874 [142467] (1 species) |
Species Thermotoga maritima [TaxId:2336] [142468] (1 PDB entry) Uniprot Q9WZX7 1-103! Uniprot Q9WZX7 104-193 |
Domain d2a6aa1: 2a6a A:1-103 [126231] complexed with unl |
PDB Entry: 2a6a (more details), 2.5 Å
SCOP Domain Sequences for d2a6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6aa1 c.55.1.9 (A:1-103) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv gigpggltglrvgiatvvglvspydipvaplnsfemtakscpa
Timeline for d2a6aa1: