Lineage for d2a5fa_ (2a5f A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1845935Protein ADP-ribosylation factor [52614] (16 species)
  7. 1845970Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)
  8. 1845972Domain d2a5fa_: 2a5f A: [126173]
    Other proteins in same PDB: d2a5fb_
    automated match to d1e0sa_
    complexed with gol, gtp, mg, na, nad

Details for d2a5fa_

PDB Entry: 2a5f (more details), 2.02 Å

PDB Description: cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2a5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5fa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

SCOPe Domain Coordinates for d2a5fa_:

Click to download the PDB-style file with coordinates for d2a5fa_.
(The format of our PDB-style files is described here.)

Timeline for d2a5fa_: