SCOPe 2.06: Domain d2a2sa2: 2a2s A:0-76

Lineage for d2a2sa2 (2a2s A:0-76)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)

8. Domain d2a2sa2: 2a2s A:0-76 [126063]
   Other proteins in same PDB: d2a2sa1, d2a2sb1
   automated match to d13gsa2
   complexed with ca, co3, gsn, mes

Details for d2a2sa2

PDB Entry: 2a2s, 1.7 Å

PDB Description: Crystal Structure of Human Glutathione Transferase in complex with S-nitrosoglutathione in the absence of reducing agent

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d2a2sa2:

Sequence; same for both SEQRES and ATOM records:

>d2a2sa2 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

Timeline for d2a2sa2:

• d2a2sa2 first appeared in SCOP 1.73
  
• d2a2sa2 appears in SCOPe 2.05
  
• d2a2sa2 appears in SCOPe 2.07
  
• d2a2sa2 appears in the current release, SCOPe 2.08