SCOPe 2.06: Domain d2a22b2: 2a22 B:1-196

Lineage for d2a22b2 (2a22 B:1-196)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)

7. Species Cryptosporidium parvum [TaxId:5807] [143937] (1 PDB entry)
   Uniprot Q5CYJ7 5-197

8. Domain d2a22b2: 2a22 B:1-196 [126026]
   Other proteins in same PDB: d2a22b3
   automated match to d2a22a1

Details for d2a22b2

PDB Entry: 2a22, 2.2 Å

PDB Description: Structure of Vacuolar Protein Sorting 29 from Cryptosporidium Parvum

PDB Compounds: (B:) vacuolar protein sorting 29

SCOPe Domain Sequences for d2a22b2:

Sequence; same for both SEQRES and ATOM records:

>d2a22b2 d.159.1.7 (B:1-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}
sstdfgdlvlligdlkipygakelpsnfrellatdkinyvlctgnvcsqeyvemlknitk
nvyivsgdldsaifnpdpesngvfpeyvvvqigefkiglmhgnqvlpwddpgsleqwqrr
ldcdilvtghthklrvfekngklflnpgtatgafsaltpdappsfmlmalqgnkvvlyvy
dlrdgktnvamsefsk

Timeline for d2a22b2:

• d2a22b2 first appeared in SCOP 1.73, called d2a22b1
  
• d2a22b2 was called d2a22b_ in SCOPe 2.05
  
• d2a22b2 appears in SCOPe 2.07
  
• d2a22b2 appears in the current release, SCOPe 2.08