Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein automated matches [190325] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries) |
Domain d2a06f_: 2a06 F: [125925] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06t_, d2a06u_, d2a06v_, d2a06w_ automated match to d1qcrf_ complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOPe Domain Sequences for d2a06f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06f_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]} wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr qqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d2a06f_:
View in 3D Domains from other chains: (mouse over for more information) d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_ |