Lineage for d1zyrf2 (1zyr F:319-423)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723765Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1723861Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 1723862Protein automated matches [254475] (3 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [255021] (1 PDB entry)
  8. 1723878Domain d1zyrf2: 1zyr F:319-423 [125857]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp3
    automated match to d1smyf2
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrf2

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (F:) DNA-directed RNA polymerase sigma chain

SCOPe Domain Sequences for d1zyrf2:

Sequence, based on SEQRES records: (download)

>d1zyrf2 a.4.13.0 (F:319-423) automated matches {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d1zyrf2 a.4.13.0 (F:319-423) automated matches {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOPe Domain Coordinates for d1zyrf2:

Click to download the PDB-style file with coordinates for d1zyrf2.
(The format of our PDB-style files is described here.)

Timeline for d1zyrf2: