Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (15 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d1zyrb2: 1zyr B:50-172 [125852] Other proteins in same PDB: d1zyra1, d1zyrb1, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrl1, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3 automatically matched to d1iw7a2 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOPe Domain Sequences for d1zyrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyrb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d1zyrb2: