SCOPe 2.08: Domain d1zwwb_: 1zww B:

Lineage for d1zwwb_ (1zww B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (4 proteins)
   sensor of membrane curvature

6. Protein Endophilin-1 [140699] (3 species)
   SH3-containing GRB2-like protein 2

7. Species Mouse (Mus musculus) [TaxId:10090] [140702] (1 PDB entry)
   Uniprot Q62420 27-246

8. Domain d1zwwb_: 1zww B: [125751]
   automated match to d2d4ca1
   complexed with cd

Details for d1zwwb_

PDB Entry: 1zww, 2.3 Å

PDB Description: Crystal structure of endophilin-A1 BAR domain

PDB Compounds: (B:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d1zwwb_:

Sequence, based on SEQRES records:

>d1zwwb_ a.238.1.1 (B:) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
kldddfkemerkvdvtsravmeimtktieylqpnpasraklsmintmskirgqekgpgyp
qaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlh
dkdlreiqhhlkklegrrldfgykkkrqgkipdeelrqalekfdeskeiaessmfnllem
dieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa

Sequence, based on observed residues (ATOM records):

>d1zwwb_ a.238.1.1 (B:) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
kldddfkemerkvdvtsravmeimtktieylqpnpasrakpqaeallaeamlkfgrelgd
dcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrl
dfgykkkrdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
ilqqvtvrleerirqa

Timeline for d1zwwb_:

• d1zwwb_ first appeared in SCOP 1.73, called d1zwwb1
  
• d1zwwb_ appears in SCOPe 2.07