SCOPe 2.06: Domain d1zujb_: 1zuj B:

Lineage for d1zujb_ (1zuj B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry)
   Uniprot A2RLG8 6-173

8. Domain d1zujb_: 1zuj B: [125673]
   automated match to d1zuja1

Details for d1zujb_

PDB Entry: 1zuj, 2.9 Å

PDB Description: The crystal structure of the Lactococcus lactis MG1363 DpsA protein

PDB Compounds: (B:) hypothetical protein Llacc01001955

SCOPe Domain Sequences for d1zujb_:

Sequence; same for both SEQRES and ATOM records:

>d1zujb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]}
sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef

Timeline for d1zujb_:

• d1zujb_ first appeared in SCOP 1.73, called d1zujb1
  
• d1zujb_ appears in SCOPe 2.05
  
• d1zujb_ appears in SCOPe 2.07
  
• d1zujb_ appears in the current release, SCOPe 2.08