Lineage for d1ztra1 (1ztr A:0-59)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981565Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1981577Protein Engrailed Homeodomain [46691] (1 species)
  7. 1981578Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 1981602Domain d1ztra1: 1ztr A:0-59 [125655]
    Other proteins in same PDB: d1ztra2
    mutant

Details for d1ztra1

PDB Entry: 1ztr (more details)

PDB Description: solution structure of engrailed homeodomain l16a mutant
PDB Compounds: (A:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d1ztra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztra1 a.4.1.1 (A:0-59) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dekrprtafsseqlarakrefnenrylterrrqqlsselglneaqikiwfqnkrakirrs

SCOPe Domain Coordinates for d1ztra1:

Click to download the PDB-style file with coordinates for d1ztra1.
(The format of our PDB-style files is described here.)

Timeline for d1ztra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ztra2