Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (13 PDB entries) Uniprot P30685 25-300 |
Domain d1zsda2: 1zsd A:1-181 [125602] Other proteins in same PDB: d1zsda1, d1zsdb_ automated match to d1xh3a2 |
PDB Entry: 1zsd (more details), 1.7 Å
SCOPe Domain Sequences for d1zsda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zsda2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq r
Timeline for d1zsda2: