SCOPe 2.04: Domain d1zrda2: 1zrd A:8-137

Lineage for d1zrda2 (1zrd A:8-137)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (30 PDB entries)

8. Domain d1zrda2: 1zrd A:8-137 [125536]
   Other proteins in same PDB: d1zrda1, d1zrdb1
   automated match to d1i5zb2
   protein/DNA complex; complexed with cmp

Details for d1zrda2

PDB Entry: 1zrd, 2.8 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6a;17t]icap38 dna

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d1zrda2:

Sequence; same for both SEQRES and ATOM records:

>d1zrda2 b.82.3.2 (A:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

Timeline for d1zrda2:

• d1zrda2 first appeared in SCOP 1.73
  
• d1zrda2 appears in SCOPe 2.03
  
• d1zrda2 appears in SCOPe 2.05
  
• d1zrda2 appears in the current release, SCOPe 2.08