![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins) |
![]() | Protein automated matches [190861] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188200] (1 PDB entry) |
![]() | Domain d1zq9b_: 1zq9 B: [125506] Other proteins in same PDB: d1zq9a1 automated match to d1zq9a1 complexed with sam |
PDB Entry: 1zq9 (more details), 1.9 Å
SCOPe Domain Sequences for d1zq9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq9b_ c.66.1.24 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qhilknpliinsiidkaalrptdvvlevgpgtgnmtvkllekakkvvaceldprlvaelh krvqgtpvasklqvlvgdvlktdlpffdtcvanlpyqisspfvfklllhrpffrcailmf qrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkvessvvriepknpp ppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadk iqqiltstgfsdkrarsmdiddfirllhgfnaegihfs
Timeline for d1zq9b_: