Lineage for d1zq9b1 (1zq9 B:36-313)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704928Family c.66.1.24: rRNA adenine dimethylase-like [88784] (4 proteins)
  6. 704933Protein Probable dimethyladenosine transferase [142575] (1 species)
  7. 704934Species Human (Homo sapiens) [TaxId:9606] [142576] (1 PDB entry)
  8. 704936Domain d1zq9b1: 1zq9 B:36-313 [125506]
    automatically matched to 1ZQ9 A:36-313
    complexed with sam

Details for d1zq9b1

PDB Entry: 1zq9 (more details), 1.9 Å

PDB Description: Crystal structure of human Dimethyladenosine transferase
PDB Compounds: (B:) Probable dimethyladenosine transferase

SCOP Domain Sequences for d1zq9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq9b1 c.66.1.24 (B:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]}
qhilknpliinsiidkaalrptdvvlevgpgtgnmtvkllekakkvvaceldprlvaelh
krvqgtpvasklqvlvgdvlktdlpffdtcvanlpyqisspfvfklllhrpffrcailmf
qrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkvessvvriepknpp
ppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadk
iqqiltstgfsdkrarsmdiddfirllhgfnaegihfs

SCOP Domain Coordinates for d1zq9b1:

Click to download the PDB-style file with coordinates for d1zq9b1.
(The format of our PDB-style files is described here.)

Timeline for d1zq9b1: